transeq

Dataset Information

Number:4
Name:transeq on data 1
Created:Tue Jun 2 13:14:37 2020 (UTC)
Filesize:18.0 KB
Dbkey:?
Format:fasta

Job Information

Galaxy Tool ID:toolshed.g2.bx.psu.edu/repos/devteam/emboss_5/EMBOSS: transeq101/5.0.0
Galaxy Tool Version:5.0.0
Tool Version:
Tool Standard Output:stdout
Tool Standard Error:stderr
Tool Exit Code:0
History Content API ID: 11ac94870d0bb33a8ea6ee6988785569
Job API ID: bd0432ba17a222f1
History API ID: 719b9d39b9c90925
UUID:3d5fcdfc-f68a-46c5-9560-a646f6863d19
Full Path:/data/dnb02/galaxy_db/files/020/507/dataset_20507302.dat

Inheritance Chain

transeq on data 1

Command Line

transeq -sequence '/data/dnb02/galaxy_db/files/020/504/dataset_20504389.dat' -outseq '/data/dnb02/galaxy_db/job_working_directory/008/537/8537885/galaxy_dataset_22330027.dat' -frame 1 -table 0 -trim no -clean no -alternative no -osformat2 'fasta' -auto

Job Dependencies

Dependency Dependency Type Version
emboss conda 5.0.0

Dataset peek

>ENST00000338702_homosapiens_1
MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHV
DYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKL